NCBI Nucleotide banner
PubMed Nucleotide Protein Genome Structure PopSet Taxonomy OMIM
 Search for
 Limits Index History Clipboard  

Please turn JavaScript on to work with this page.
as     
1: U55761  Cloning vector pEGFP-1, complete sequence, enhanced green fluorescent protein (egfp) and neomycin phosphotransferase genes, complete cds Protein, Related Sequences, Taxonomy
LOCUS       CVU55761     4151 bp    DNA   circular  SYN       15-JUN-1996
DEFINITION  Cloning vector pEGFP-1, complete sequence, enhanced green
            fluorescent protein (egfp) and neomycin phosphotransferase genes,
            complete cds.
ACCESSION   U55761
VERSION     U55761.1  GI:1377908
KEYWORDS    .
SOURCE      Cloning vector pEGFP-1.
  ORGANISM  Cloning vector pEGFP-1
            artificial sequence; vectors.
REFERENCE   1  (bases 1 to 4151)
  AUTHORS   Cormack,B.P., Valdivia,R. and Falkow,S.
  TITLE     FACS-optimized mutants of the green fluorescent protein (GFP)
  JOURNAL   Gene (1996) In press
REFERENCE   2  (bases 1 to 4151)
  AUTHORS   Kitts,P.A.
  TITLE     pEGFP-1 complete sequence
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4151)
  AUTHORS   Kitts,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-APR-1996) Paul A. Kitts, CLONTECH Laboratories, Inc.,
            1020 East Meadow Circle, Palo Alto, CA 94303-4230, USA
COMMENT     This vector can be obtained from CLONTECH Laboratories, Inc., 1020
            East  Meadow Circle, Palo Alto, CA 94303-4230, USA. To place an
            order call  (415) 424-8222 or (800) 662-2566, extension 1.
            International customers,  please contact your local distributor.
            For technical information, call  (415) 424-8222 or (800) 662-2566,
            extension 3.
            This sequence has been compiled from information in the sequence
            databases,  published literature and other sources, together with
            partial sequences  obtained by CLONTECH. If you suspect there is an
            error in this sequence,  please contact CLONTECH's Technical
            Service Department at (415) 424-8222 or  (800) 662-2566, extension
            3 or E-mail TECH@CLONTECH.COM.
FEATURES             Location/Qualifiers
     source          1..4151
                     /organism="Cloning vector pEGFP-1"
                     /db_xref="taxon:47944"
     gene            97..816
                     /gene="egfp"
     CDS             97..816
                     /gene="egfp"
                     /codon_start=1
                     /transl_table=11
                     /product="enhanced green fluorescent protein"
                     /protein_id="AAB02572.1"
                     /db_xref="GI:1377909"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLT
                     LKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFK
                     DDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN
                     GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDH
                     MVLLEFVTAAGITLGMDELYK"
     CDS             2047..2841
                     /codon_start=1
                     /transl_table=11
                     /product="neomycin phosphotransferase"
                     /protein_id="AAB02573.1"
                     /db_xref="GI:1377910"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGR
                     PVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDL
                     LSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE
                     EHQGLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRY
                     QDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
BASE COUNT      994 a   1142 c   1105 g    910 t
ORIGIN      
        1 tagttattac tagcgctacc ggactcagat ctcgagctca agcttcgaat tctgcagtcg
       61 acggtaccgc gggcccggga tccaccggtc gccaccatgg tgagcaaggg cgaggagctg
      121 ttcaccgggg tggtgcccat cctggtcgag ctggacggcg acgtaaacgg ccacaagttc
      181 agcgtgtccg gcgagggcga gggcgatgcc acctacggca agctgaccct gaagttcatc
      241 tgcaccaccg gcaagctgcc cgtgccctgg cccaccctcg tgaccaccct gacctacggc
      301 gtgcagtgct tcagccgcta ccccgaccac atgaagcagc acgacttctt caagtccgcc
      361 atgcccgaag gctacgtcca ggagcgcacc atcttcttca aggacgacgg caactacaag
      421 acccgcgccg aggtgaagtt cgagggcgac accctggtga accgcatcga gctgaagggc
      481 atcgacttca aggaggacgg caacatcctg gggcacaagc tggagtacaa ctacaacagc
      541 cacaacgtct atatcatggc cgacaagcag aagaacggca tcaaggtgaa cttcaagatc
      601 cgccacaaca tcgaggacgg cagcgtgcag ctcgccgacc actaccagca gaacaccccc
      661 atcggcgacg gccccgtgct gctgcccgac aaccactacc tgagcaccca gtccgccctg
      721 agcaaagacc ccaacgagaa gcgcgatcac atggtcctgc tggagttcgt gaccgccgcc
      781 gggatcactc tcggcatgga cgagctgtac aagtaaagcg gccgcgactc tagatcataa
      841 tcagccatac cacatttgta gaggttttac ttgctttaaa aaacctccca cacctccccc
      901 tgaacctgaa acataaaatg aatgcaattg ttgttgttaa cttgtttatt gcagcttata
      961 atggttacaa ataaagcaat agcatcacaa atttcacaaa taaagcattt ttttcactgc
     1021 attctagttg tggtttgtcc aaactcatca atgtatctta aggcgtaaat tgtaagcgtt
     1081 aatattttgt taaaattcgc gttaaatttt tgttaaatca gctcattttt taaccaatag
     1141 gccgaaatcg gcaaaatccc ttataaatca aaagaataga ccgagatagg gttgagtgtt
     1201 gttccagttt ggaacaagag tccactatta aagaacgtgg actccaacgt caaagggcga
     1261 aaaaccgtct atcagggcga tggcccacta cgtgaaccat caccctaatc aagttttttg
     1321 gggtcgaggt gccgtaaagc actaaatcgg aaccctaaag ggagcccccg atttagagct
     1381 tgacggggaa agccggcgaa cgtggcgaga aaggaaggga agaaagcgaa aggagcgggc
     1441 gctagggcgc tggcaagtgt agcggtcacg ctgcgcgtaa ccaccacacc cgccgcgctt
     1501 aatgcgccgc tacagggcgc gtcaggtggc acttttcggg gaaatgtgcg cggaacccct
     1561 atttgtttat ttttctaaat acattcaaat atgtatccgc tcatgagaca ataaccctga
     1621 taaatgcttc aataatattg aaaaaggaag agtcctgagg cggaaagaac cagctgtgga
     1681 atgtgtgtca gttagggtgt ggaaagtccc caggctcccc agcaggcaga agtatgcaaa
     1741 gcatgcatct caattagtca gcaaccaggt gtggaaagtc cccaggctcc ccagcaggca
     1801 gaagtatgca aagcatgcat ctcaattagt cagcaaccat agtcccgccc ctaactccgc
     1861 ccatcccgcc cctaactccg cccagttccg cccattctcc gccccatggc tgactaattt
     1921 tttttattta tgcagaggcc gaggccgcct cggcctctga gctattccag aagtagtgag
     1981 gaggcttttt tggaggccta ggcttttgca aagatcgatc aagagacagg atgaggatcg
     2041 tttcgcatga ttgaacaaga tggattgcac gcaggttctc cggccgcttg ggtggagagg
     2101 ctattcggct atgactgggc acaacagaca atcggctgct ctgatgccgc cgtgttccgg
     2161 ctgtcagcgc aggggcgccc ggttcttttt gtcaagaccg acctgtccgg tgccctgaat
     2221 gaactgcaag acgaggcagc gcggctatcg tggctggcca cgacgggcgt tccttgcgca
     2281 gctgtgctcg acgttgtcac tgaagcggga agggactggc tgctattggg cgaagtgccg
     2341 gggcaggatc tcctgtcatc tcaccttgct cctgccgaga aagtatccat catggctgat
     2401 gcaatgcggc ggctgcatac gcttgatccg gctacctgcc cattcgacca ccaagcgaaa
     2461 catcgcatcg agcgagcacg tactcggatg gaagccggtc ttgtcgatca ggatgatctg
     2521 gacgaagagc atcaggggct cgcgccagcc gaactgttcg ccaggctcaa ggcgagcatg
     2581 cccgacggcg aggatctcgt cgtgacccat ggcgatgcct gcttgccgaa tatcatggtg
     2641 gaaaatggcc gcttttctgg attcatcgac tgtggccggc tgggtgtggc ggaccgctat
     2701 caggacatag cgttggctac ccgtgatatt gctgaagagc ttggcggcga atgggctgac
     2761 cgcttcctcg tgctttacgg tatcgccgct cccgattcgc agcgcatcgc cttctatcgc
     2821 cttcttgacg agttcttctg agcgggactc tggggttcga aatgaccgac caagcgacgc
     2881 ccaacctgcc atcacgagat ttcgattcca ccgccgcctt ctatgaaagg ttgggcttcg
     2941 gaatcgtttt ccgggacgcc ggctggatga tcctccagcg cggggatctc atgctggagt
     3001 tcttcgccca ccctaggggg aggctaactg aaacacggaa ggagacaata ccggaaggaa
     3061 cccgcgctat gacggcaata aaaagacaga ataaaacgca cggtgttggg tcgtttgttc
     3121 ataaacgcgg ggttcggtcc cagggctggc actctgtcga taccccaccg agaccccatt
     3181 ggggccaata cgcccgcgtt tcttcctttt ccccacccca ccccccaagt tcgggtgaag
     3241 gcccagggct cgcagccaac gtcggggcgg caggccctgc catagcctca ggttactcat
     3301 atatacttta gattgattta aaacttcatt tttaatttaa aaggatctag gtgaagatcc
     3361 tttttgataa tctcatgacc aaaatccctt aacgtgagtt ttcgttccac tgagcgtcag
     3421 accccgtaga aaagatcaaa ggatcttctt gagatccttt ttttctgcgc gtaatctgct
     3481 gcttgcaaac aaaaaaacca ccgctaccag cggtggtttg tttgccggat caagagctac
     3541 caactctttt tccgaaggta actggcttca gcagagcgca gataccaaat actgtccttc
     3601 tagtgtagcc gtagttaggc caccacttca agaactctgt agcaccgcct acatacctcg
     3661 ctctgctaat cctgttacca gtggctgctg ccagtggcga taagtcgtgt cttaccgggt
     3721 tggactcaag acgatagtta ccggataagg cgcagcggtc gggctgaacg gggggttcgt
     3781 gcacacagcc cagcttggag cgaacgacct acaccgaact gagataccta cagcgtgagc
     3841 tatgagaaag cgccacgctt cccgaaggga gaaaggcgga caggtatccg gtaagcggca
     3901 gggtcggaac aggagagcgc acgagggagc ttccaggggg aaacgcctgg tatctttata
     3961 gtcctgtcgg gtttcgccac ctctgacttg agcgtcgatt tttgtgatgc tcgtcagggg
     4021 ggcggagcct atggaaaaac gccagcaacg cggccttttt acggttcctg gccttttgct
     4081 ggccttttgc tcacatgttc tttcctgcgt tatcccctga ttctgtggat aaccgtatta
     4141 ccgccatgca t
//